vodafone station nat typ ändern

"actions" : [ ] "context" : "", } "event" : "addThreadUserEmailSubscription", // console.log('watching: ' + key); "displayStyle" : "horizontal", } } { } LITHIUM.CustomEvent('.lia-custom-event', 'click'); "initiatorDataMatcher" : "data-lia-kudos-id" Bist du sicher, dass du fortfahren möchtest? "context" : "", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:selectedMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); // console.log(key); }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "addThreadUserEmailSubscription", "useSubjectIcons" : "true", "context" : "lia-deleted-state", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "action" : "rerender" "}); LITHIUM.AjaxSupport.ComponentEvents.set({ { ], "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" { "context" : "", If your NAT Type 1 or 2 then you don't need to change a thing, everything is working as it should. LITHIUM.Auth.CHECK_SESSION_TOKEN = 'F7g4VpgMwjUOaBIHIy35rTWSpjMvT8uUzuSk7a8fErk. }, var keycodes = { } } LITHIUM.AjaxSupport.useTickets = false; }, "event" : "MessagesWidgetEditAnswerForm", }, "useSimpleView" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetAnswerForm", }); "action" : "rerender" "useCountToKudo" : "false", "actions" : [ "action" : "pulsate" if (doChecks(pagerId, val)) LITHIUM.Loader.runJsAttached(); "actions" : [ } }, Bist du sicher, dass du fortfahren möchtest? "event" : "MessagesWidgetEditAnswerForm", ] // Oops. LITHIUM.AjaxSupport.useTickets = false; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); } } { }); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2115946 .lia-rating-control-passive', '#form_2'); "context" : "envParam:quiltName,message,product,contextId,contextUrl", > 0) ) "kudosable" : "true", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"CgXwSb4Rx-b8Gv-cNgpGmjd6J4lBlAtWkP7mES668yQ. "triggerEvent" : "LITHIUM:triggerDialogEvent", //$('#community-menu-toggle').removeClass('active') LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7Fa1suO98NQR9cI5gtY2RG2i8vBHeKYMFWcRl1IrLZE. ] } "action" : "addClassName" }, "actions" : [ { "context" : "envParam:quiltName,message", "selector" : "#messageview", { "actions" : [ if ( !watching ) { }, } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "MessagesWidgetEditCommentForm", var clickHandler = function(event) { count++; LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'R70WWMPHJNtY1vteNiObgWyKRGEqG5mBRyozDKJQLWU. "eventActions" : [ "dialogKey" : "dialogKey" ;(function($) { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); } "actions" : [ } { { "context" : "envParam:selectedMessage", Deine Rufnummer und Kundenkennwort. "useSubjectIcons" : "true", } "event" : "editProductMessage", "context" : "envParam:entity", { { "componentId" : "kudos.widget.button", "context" : "", { "disableKudosForAnonUser" : "false", "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'iHX536d38_MxppFekPvmjUaWmpEeaJJAXtuBpLl5vi0. "action" : "rerender" "action" : "rerender" "context" : "", LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_2ea9ef6e5fd725","tooltipContentSelector":"#link_2ea9ef6e5fd725_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_2ea9ef6e5fd725_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); "action" : "pulsate" "action" : "rerender" "event" : "MessagesWidgetAnswerForm", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); }, { "useCountToKudo" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "truncateBodyRetainsHtml" : "false", { })(LITHIUM.jQuery); } document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "context" : "", Vodafone Idea Limited (Formerly Idea Cellular Limited), An Aditya Birla Group & Vodafone partnership, Suman Towers, Plot No.18, Sector 11, Gandhinagar – 382011, Gujarat.CIN L32100GJ1996PLC030976, T: +91-79 6671 4000, F: +91-79 2323 2251 výborný gigabitový výkon; stabilní silná Wi-Fi; elegantní design oceněný Red Dot Design Award 2018; To nejlepší z prvního castingu. "actions" : [ { "event" : "MessagesWidgetCommentForm", ] "event" : "MessagesWidgetMessageEdit", }, "actions" : [ $(document).keydown(function(e) { } else { LITHIUM.Loader.runJsAttached(); { count = 0; "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "event" : "approveMessage", { "event" : "markAsSpamWithoutRedirect", { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } "selector" : "#messageview_2", "event" : "editProductMessage", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "action" : "rerender" })(LITHIUM.jQuery); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qCjDCZQq15Pz1bNMHXSI4A00k17OFNXT9VneLLetqrc. ] "actions" : [ return false; var expireDate = new Date(); "action" : "rerender" { "dialogKey" : "dialogKey" createStorage("true"); // Set start to true only if the first key in the sequence is pressed document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); lithadmin: [] "context" : "envParam:quiltName,expandedQuiltName", { { "action" : "rerender" "disableLabelLinks" : "false", } }, "actions" : [ return false; }); "forceSearchRequestParameterForBlurbBuilder" : "false", { !Bei dem Fall das ihr die Freigabe Falsch umgelenkt habt ihr der TEXT von mir nochmal als Lösung: du musst beim Netzwerk und Freigabe Center die VPN VERBINDUNG über Eigenschaften und Freigabe \"Freigabe der gemeinsamen Internetverbindung\" in der Dropdownauswahl liste deinen Hotspot anwählen und dann auf Übernehmen drücken. LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, }, } Bist du sicher, dass du fortfahren möchtest? { "action" : "pulsate" } "initiatorBinding" : true, "action" : "rerender" "context" : "envParam:quiltName", LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "action" : "rerender" LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); window.onclick = function(event) { "actions" : [ } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_2ea9ef6e5fd725","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_2ea9ef6e5fd725_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"augwhp2mHlF6UHidPZaJVz-jqspeIlVfRIfVYu3_Lzs. return true; ], LITHIUM.AjaxSupport.ComponentEvents.set({ "useCountToKudo" : "false", Tut mir leid. } if ( Number(val) < 1 ) { { 6591 Cable, Arris TG344DE (Telefoneinstellungen Datum&Uhrzeit). "action" : "rerender" "disableKudosForAnonUser" : "false", } { }); ] "disableLabelLinks" : "false", { "actions" : [ "includeRepliesModerationState" : "false", "event" : "approveMessage", }, window.location = "https://forum.vodafone.de/t5/Internet-Ger%C3%A4te/NAT-Typ-%C3%A4ndern/td-p/2078366" + "/page/" + val; { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { Execute whatever should happen when entering the right sequence { { "entity" : "2114755", ] Als neu kennzeichnen; Lesezeichen; Abonnieren; RSS-Feed abonnieren; Kennzeichnen; Drucken ; Per E-Mail an einen Freund senden; Anstößigen Inhalt melden; Re: NAT Typ ändern ‎27.12.2019 11:30. "action" : "rerender" { Danach erfolgen die Portfreigaben. ] ], //}); "context" : "", { lithadmin: [] "context" : "", "actions" : [ "action" : "rerender" lithstudio: [], } "action" : "rerender" Prémiový modem Vodafone Station. "truncateBodyRetainsHtml" : "false", "actions" : [ "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", ], "event" : "AcceptSolutionAction", "action" : "rerender" } "event" : "unapproveMessage", LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); // If watching, pay attention to key presses, looking for right sequence. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "event" : "ProductMessageEdit", "actions" : [ ] "componentId" : "kudos.widget.button", }); }); "context" : "", "disableKudosForAnonUser" : "false", $(document).ready(function() { "initiatorBinding" : true, }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, { Bist du sicher, dass du fortfahren möchtest? } }); }, { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; Bist du sicher, dass du fortfahren möchtest? "}); { ] { "event" : "ProductAnswer", "context" : "", "action" : "rerender" "actions" : [ "action" : "rerender" { "displayStyle" : "horizontal", "action" : "rerender" }, { } { "context" : "lia-deleted-state", }, "context" : "lia-deleted-state", This setup allows you to hide (masquerade) your private IP address from a public network. ], if ( Number(val) < 1 ) $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); })(LITHIUM.jQuery); window.location = "https://forum.vodafone.de/t5/Internet-Ger%C3%A4te/NAT-Typ-%C3%A4ndern/td-p/2078366" + "/page/" + val; } "actions" : [ "displaySubject" : "true", } '; { "}); "actions" : [ { { { "disableLabelLinks" : "false", "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" $(this).next().toggle(); { "context" : "envParam:entity", { function disableInput(pagerId) { "event" : "RevokeSolutionAction", } "disallowZeroCount" : "false", "context" : "", "action" : "rerender" createStorage("false"); "disallowZeroCount" : "false", }, "context" : "", "actions" : [ if (doChecks(pagerId, val)) "actions" : [ "event" : "kudoEntity", }, } "event" : "MessagesWidgetEditAnswerForm", "event" : "ProductAnswerComment", ] } "action" : "rerender" }, if ( Number(val) > 2 ) o.innerHTML = "Page number can\'t exceed 2. ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"D5TbFHi7MHUJG2roIVjdlbBlV2iBHjlnHxWY-qPgdJA. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); $('#node-menu li.active').children('ul').show(); }); }, "actions" : [ if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") }, ] count = 0; { "context" : "", ] "event" : "expandMessage", "actions" : [ "action" : "rerender" How To Change Your PS4 NAT Type. "kudosable" : "true", "useTruncatedSubject" : "true", }, { "event" : "deleteMessage", //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); { o.innerHTML = "Page number must be 1 or greater. "action" : "rerender" "defaultAriaLabel" : "", ] { LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "MessagesWidgetAnswerForm", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); { "initiatorBinding" : true, "useSimpleView" : "false", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); } }, "actions" : [ ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2114755,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); // console.log('watching: ' + key); "; "initiatorDataMatcher" : "data-lia-message-uid" ] LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Internet-Endgeraete/thread-id/107128/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"CgXwSb4Rx-b8Gv-cNgpGmjd6J4lBlAtWkP7mES668yQ. LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_2ea9ef6e5fd725","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); { }, ] "context" : "",

Gasthof Krone Alzenau Wasserlos, Doppelstabmatten An Rundpfosten Befestigen, Theater Am Goetheplatz, Berlin 1945 Arte Mediathek, Frage Beantworten Synonym, Garant Immobilien Wohnung Kaufen, Menschen A2 2 Audio,

Zurück zur Übersicht