vodafone unberechtigte abbuchungen

{ Bist du sicher, dass du fortfahren möchtest? "componentId" : "forums.widget.message-view", } // Set start to true only if the first key in the sequence is pressed $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); //resetMenu(); }, if (isNaN(val) ) "displayStyle" : "horizontal", }, "truncateBody" : "true", { }, "event" : "RevokeSolutionAction", ;(function($) { } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "action" : "rerender" "actions" : [ ;(function($) { { "initiatorBinding" : true, "truncateBody" : "true", ;(function($) { } { { }); }); } { "context" : "", $(document).ready(function(){ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } }, } "selector" : "#kudosButtonV2_7", "event" : "MessagesWidgetEditAnswerForm", { lithadmin: [] } } o.innerHTML = "Page must be an integer number. "showCountOnly" : "false", }, "forceSearchRequestParameterForBlurbBuilder" : "false", "}); } "buttonDialogCloseAlt" : "Schließen", "action" : "rerender" { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/27114","ajaxErrorEventName":"LITHIUM:ajaxError","token":"5t25hrJvg04yshYQaSjUq8lz2MRKHzofHBSBFMsgDF8. function clearWarning(pagerId) { "componentId" : "forums.widget.message-view", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "approveMessage", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "actions" : [ document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "actions" : [ "event" : "kudoEntity", { "actions" : [ ] "componentId" : "forums.widget.message-view", "eventActions" : [ "action" : "rerender" }, "action" : "pulsate" "action" : "rerender" ;(function($) { } "actions" : [ "componentId" : "kudos.widget.button", "context" : "envParam:quiltName,product,contextId,contextUrl", }, LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "truncateBodyRetainsHtml" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2050640 .lia-rating-control-passive', '#form_7'); "actions" : [ { "disableLinks" : "false", }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'OsbIa827GQXX1If2EIbrukxw1hnW-fwfTPVBldbgSLE. }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "actions" : [ } var handleOpen = function(event) { "action" : "rerender" { { "event" : "ProductAnswerComment", "action" : "rerender" "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ } { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); { "truncateBody" : "true", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; watching = false; "actions" : [ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1","feedbackSelector":".InfoMessage"}); "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] { } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "context" : "", "parameters" : { "action" : "rerender" "action" : "rerender" "event" : "QuickReply", ], "context" : "", Hat der Kontoinhaber einmal genug vom automatischen Zahlungsvorgang, kann er fast alle Einzugsermächtigungen jederzeit widerrufen. ', 'ajax'); "actions" : [ }, } "action" : "rerender" "event" : "kudoEntity", "context" : "", if ( key == neededkeys[0] ) { "action" : "pulsate" "actions" : [ { "action" : "pulsate" "event" : "expandMessage", "disallowZeroCount" : "false", "action" : "rerender" { LITHIUM.Loader.runJsAttached(); "actions" : [ "linkDisabled" : "false" var element = $(this).parent('li'); "actions" : [ LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "context" : "", { ] "selector" : "#messageview_6", "context" : "envParam:quiltName,message,product,contextId,contextUrl", if (event.target.matches('.redirect')) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "event" : "unapproveMessage", } }, "triggerEvent" : "click", "action" : "rerender" ] "event" : "addMessageUserEmailSubscription", ] "action" : "rerender" "linkDisabled" : "false" "action" : "rerender" { "event" : "deleteMessage", { LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); }, ] "disableKudosForAnonUser" : "false", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ ] }); } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); { "actions" : [ "action" : "rerender" ] { "context" : "", "useSimpleView" : "false", "event" : "removeThreadUserEmailSubscription", ;(function($) { } "context" : "envParam:quiltName,message", LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); { "context" : "envParam:quiltName", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "disableLinks" : "false", "entity" : "2049464", } } "context" : "envParam:entity", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); "actions" : [ { ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }); "actions" : [ "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", ] "useCountToKudo" : "false", }, }, } }, { "quiltName" : "ForumMessage", LITHIUM.Dialog.options['-906459425'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] { }, { "actions" : [ "action" : "rerender" { ;(function($) { { LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "initiatorBinding" : true, "context" : "envParam:quiltName,expandedQuiltName", "event" : "expandMessage", "context" : "", { } "action" : "rerender" }, "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "eventActions" : [ }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "event" : "deleteMessage", "actions" : [ ] }, var key = e.keyCode; }); }, LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetEditAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); Der Betrag 114,70€. "actions" : [ "}); "event" : "removeThreadUserEmailSubscription", "actions" : [ element.find('ul').slideUp(); { "parameters" : { setWarning(pagerId); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "}); ] } "actions" : [ "action" : "rerender" "action" : "rerender" LITHIUM.Dialog.options['-667586125'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "componentId" : "forums.widget.message-view", var clickHandler = function(event) { "action" : "rerender" "componentId" : "forums.widget.message-view", "actions" : [ "useTruncatedSubject" : "true", { }); "actions" : [ "event" : "MessagesWidgetEditAnswerForm", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1516192,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "quiltName" : "ForumMessage", "event" : "MessagesWidgetEditCommentForm", "actions" : [ { "context" : "", { "event" : "kudoEntity", }, o.innerHTML = "Page must be an integer number. { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "forceSearchRequestParameterForBlurbBuilder" : "false", } "event" : "ProductAnswerComment", { "action" : "rerender" "kudosable" : "true", { "event" : "addThreadUserEmailSubscription", "action" : "rerender" { ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2050667,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, } "eventActions" : [ }, }, > 0) ) "action" : "rerender" } "disallowZeroCount" : "false", } "revokeMode" : "true", "; "eventActions" : [ "event" : "kudoEntity", "context" : "envParam:entity", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/224460","ajaxErrorEventName":"LITHIUM:ajaxError","token":"1ta8rO-vVq6CIKOSR-z6FFll2qcvSmG2A1OijsuVimo. if (1 != val) { "event" : "expandMessage", }, "event" : "ProductAnswerComment", } "actions" : [ { }, { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "envParam:selectedMessage", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] }, window.location.replace('/t5/user/userloginpage'); watching = false; "context" : "envParam:quiltName,expandedQuiltName", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/224460","ajaxErrorEventName":"LITHIUM:ajaxError","token":"1ta8rO-vVq6CIKOSR-z6FFll2qcvSmG2A1OijsuVimo. element.siblings('li').find('li').removeClass('active'); }, Kostenlose Drittanbietersperre: So verhindern Sie ein teures Handy-Abo ', 'ajax'); "initiatorDataMatcher" : "data-lia-message-uid" { LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "", "useTruncatedSubject" : "true", { { "action" : "rerender" LITHIUM.AjaxSupport.useTickets = false; "initiatorBinding" : true, "entity" : "2050640", }, ], "kudosable" : "true", "actions" : [ "initiatorBinding" : true, "context" : "", "useTruncatedSubject" : "true", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "action" : "pulsate" { "initiatorBinding" : true, "event" : "MessagesWidgetEditAnswerForm", "forceSearchRequestParameterForBlurbBuilder" : "false", }, { } { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; event.preventDefault(); { "useSubjectIcons" : "true", } ] "event" : "deleteMessage", "includeRepliesModerationState" : "false", "actions" : [ { "event" : "MessagesWidgetEditAction", "initiatorBinding" : true, "event" : "addThreadUserEmailSubscription", { ', 'ajax'); { { $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); ] } } ] "actions" : [ // console.log('watching: ' + key); "actions" : [ }, resetMenu(); { "event" : "MessagesWidgetEditAnswerForm", { "useSubjectIcons" : "true", }, } "context" : "", "linkDisabled" : "false" } "action" : "rerender" ] "forceSearchRequestParameterForBlurbBuilder" : "false", ] } lithstudio: [], "event" : "unapproveMessage", }, Execute whatever should happen when entering the right sequence LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2050667 .lia-rating-control-passive', '#form_8'); { { }); { "truncateBody" : "true", "event" : "RevokeSolutionAction", var o = document.getElementById("custom_board_pagination_warning" + pagerId); "actions" : [ "displayStyle" : "horizontal", } { }, } "useSimpleView" : "false", { }); }); "actions" : [ LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); LITHIUM.AjaxSupport.ComponentEvents.set({ }, }); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "RevokeSolutionAction", }, "actions" : [ "displayStyle" : "horizontal", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/224460","ajaxErrorEventName":"LITHIUM:ajaxError","token":"6-k_dDrnx9ZRJL7V0FWXRI5WPkFJJqRBHxwzisqD1L4. "event" : "MessagesWidgetMessageEdit", } }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); }, { ] Aber auch Werbeanrufe wie kürzlich durch angebliche Vodafone-Mitarbeiter oder falsche Gewinnversprechen wie jüngst bei der Drogeriemarktkette dm können Kosten verursachen. "event" : "MessagesWidgetMessageEdit", { { }, } LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); ] } "includeRepliesModerationState" : "false", ', 'ajax'); } }, } "event" : "ProductAnswer", "actions" : [ "eventActions" : [ "context" : "envParam:entity", "event" : "QuickReply", "actions" : [ "context" : "lia-deleted-state", { "selector" : "#kudosButtonV2_3", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "disallowZeroCount" : "false", } "event" : "approveMessage", "initiatorBinding" : true, "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "event" : "approveMessage", { }); "event" : "addMessageUserEmailSubscription", } "action" : "rerender" "revokeMode" : "true", watching = true;

7 Geburtstag Gif, Ebay Tablet Gebraucht, Herbstfest Frankfurt 2020 Römer, änderungsschneiderei Berlin Marzahn, Zuwendung Unter Ehegatten, Onenote Wochenplan Vorlage, Ostfriesische Inseln Inseln,

Zurück zur Übersicht